PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01117.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 411aa    MW: 46565.9 Da    PI: 8.4172
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01117.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.21.6e-49441701128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWka
  Sme2.5_01117.1_g00008.1  44 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPgKSVVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKA 128
                              579************************777.99***************878888999***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgk+++v+s + + +g+k+tLvf+ grapkg++t+W+mhey +
  Sme2.5_01117.1_g00008.1 129 TGKERNVKS-GANMIGTKRTLVFHIGRAPKGQRTHWIMHEYCM 170
                              *********.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5641187IPR003441NAC domain
PROSITE profilePS5100553.94944188IPR003441NAC domain
PfamPF023651.5E-2646169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MEDRDGDLLG CNNKNGEIGD RSKISISNGG EKNVEISLAT ASTMFPGFRF CPTDEELISY  60
YLKKKVEGSD KCVEVISEVE IWKHEPWDLP GKSVVQSDNE WFFFSPRGRK YPNGSQSKRA  120
TESGYWKATG KERNVKSGAN MIGTKRTLVF HIGRAPKGQR THWIMHEYCM MESPHYQDSM  180
VVCRLRKNNE FHLNDTPGNQ RNHLAVNNGA TALSRVVQLN GLGLINGAEC CSKEASSSFS  240
SHSVEQIESG SESDKLNKEL PQHHSSSSWK DCDEEDCFAD IMKDDIIKLD ESSDKAKHNL  300
LPTITRKLES STTLPTSQEA ENLMSHRLPF QGTANRRLKL QTEKVPRQVE RSEPHEVIKK  360
NSHARGISRK LINIIPVRRM KQWSIPLLLV SLMLLVVFLC LFGVPQQVKW H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-463518911169NAC domain-containing protein 19
3swm_B4e-463518911169NAC domain-containing protein 19
3swm_C4e-463518911169NAC domain-containing protein 19
3swm_D4e-463518911169NAC domain-containing protein 19
3swp_A4e-463518911169NAC domain-containing protein 19
3swp_B4e-463518911169NAC domain-containing protein 19
3swp_C4e-463518911169NAC domain-containing protein 19
3swp_D4e-463518911169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-152HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158695.10.0PREDICTED: NAC domain-containing protein 40-like
SwissprotQ9XIN75e-85NAC40_ARATH; NAC domain-containing protein 40
TrEMBLM1BQC90.0M1BQC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.14e-83NTM1-like 8